Ki *UddlmZddlZddlZddlZddlZddlmZmZm Z m Z ddl m Z ddl mZmZddlmZddlmZddlmZmZmZmZddlZdd lmZmZdd lmZdd lmZdd l m!Z!dd l"m#Z#m$Z$m%Z%m&Z&m'Z'm(Z(m)Z)m*Z*m+Z+m,Z,m-Z-ddl"m.Z/ddl"m0Z1ddl"m2Z3ddl4m5Z5ddl6m7Z7ddl8m9Z9ddl:m;Z;ddlm?Z?m@Z@mAZAmBZBmCZCddlDmEZEmFZFmGZGddlHmIZImJZJmKZKddlHmLZMddlNmOZOddlPmQZQddlRmSZSmTZTddlUmVZVeTeWZXdeYd <eXjd!"Z[deYd#<eSe[d$%e;d&e'Z\e;d(e]'Z^ed)Z_ed*d'Z`d+eYd,<ejZbeGd-d.Zcejejejejejejejejd/Zie d9d1ZjeGd2d0Zk d: d;d3Zldd6Zo d?d7Zp d@d8Zqy)A) annotationsN)Callable GeneratorMappingSequence)contextmanager) ContextVarToken) dataclass)Logger)AnyLiteralcastoverload) LoggingLevel ServerSession)ReadResourceContents) request_ctx)RequestContext) CreateMessageResultCreateMessageResultWithToolsGetPromptResultModelPreferencesRootSamplingMessageSamplingMessageContentBlock TextContent ToolChoiceToolResultContentToolUseContent)Prompt)Resource)Tool)ValidationError)AnyUrl)Request)TypeVar)settings)AcceptedElicitationCancelledElicitationDeclinedElicitationhandle_elicit_acceptparse_elicit_response_type) SampleStepSamplingResult SamplingTool)_parse_model_preferencescall_sampling_handlerdetermine_handler_mode) execute_tools)FastMCP)compress_schema) _clamp_logger get_logger)get_cached_typeadapter)namer logger to_client)suffixto_client_loggerDEBUG)r; max_levelT)defaultResultTautorequirednonecontextzContextVar[Context | None]_current_contextc*eZdZUdZded<dZded<y)LogDatazData object for passing log arguments to client-side handlers. This provides an interface to match the Python standard library logging, for compatibility with structured logging. strmsgNMapping[str, Any] | Noneextra)__name__ __module__ __qualname____doc____annotations__rOb/home/jay/workspace/scripts/.codegraph-venv/lib/python3.12/site-packages/fastmcp/server/context.pyrKrKSs H&*E #*rVrK)debuginfonoticewarningerrorcriticalalert emergencyContextc#Ktj|} |tj|y#tj|wxYwwN)rIsetreset)rHtokens rW set_contextrfks=   )E& u%u%sA 3A A  A c DeZdZdZd-dZed.dZd/dZd0dZed1dZ d2 d3dZ d4d Z d5d Z d6 d7d Z d8d Z d9 d:d Zed;dZeddZ d2 d>dZ d2 d>dZ d2 d>dZd?dZd0dZd0dZd0dZd0dZddddddddd d@dZeddddddd dAdZedddddddd  dBd!Zdddddddd  dCd"Ze dDd#Z e dEd$Z e dFd%Z d6 dGd&Z dHd'Z!dId(Z"d0d)Z#d0d*Z$d0d+Z%d0d,Z&y)Jr`aContext object providing access to MCP capabilities. This provides a cleaner interface to MCP's RequestContext functionality. It gets injected into tool and resource functions that request it via type hints. To use context in a tool function, add a parameter with the Context type annotation: ```python @server.tool async def my_tool(x: int, ctx: Context) -> str: # Log messages to the client await ctx.info(f"Processing {x}") await ctx.debug("Debug info") await ctx.warning("Warning message") await ctx.error("Error message") # Report progress await ctx.report_progress(50, 100, "Processing") # Access resources data = await ctx.read_resource("resource://data") # Get request info request_id = ctx.request_id client_id = ctx.client_id # Manage state across the request ctx.set_state("key", "value") value = ctx.get_state("key") return str(x) ``` State Management: Context objects maintain a state dictionary that can be used to store and share data across middleware and tool calls within a request. When a new context is created (nested contexts), it inherits a copy of its parent's state, ensuring that modifications in child contexts don't affect parent contexts. The context parameter name can be anything as long as it's annotated with Context. The context is optional - tools that don't need it can omit the parameter. crtj||_g|_t |_i|_yrb)weakrefref_fastmcp_tokensrc_notification_queue_stateselffastmcps rW__init__zContext.__init__s*.5kk'.B $& -0U &( rVc@|j}| td|S)zGet the FastMCP instance.z'FastMCP instance is no longer available)rk RuntimeErrorros rWrqzContext.fastmcps%--/ ?HI IrVc&Ktjd}|$tj|j|_tj |}|j j|ddlm }m }m }|j tj|j|_|j}|j |j |j |_|j$ |j |j$|_|Sw)zFEnter the context manager and set this context as the current context.Nr_current_docket_current_server_current_worker)rIgetcopydeepcopyrnrcrlappendfastmcp.server.dependenciesrwrxryrirjrq _server_token_docket _docket_token_worker _worker_token)rpparent_contextrerwrxryservers rW __aenter__zContext.__aenter__s)--d3  %--(=(=>DK!$$T* E"  -00T\\1JK  >> %!0!4!4V^^!DD  >> %!0!4!4V^^!DD  sDDcK|jd{ddlm}m}m}t |dr'|j |jt|dt |dr'|j |jt|dt |dr'|j |jt|d|jr0|jj}tj |yy7w)z9Exit the context manager and reset the most recent token.Nrrvrrr)_flush_notificationsr~rwrxryhasattrrdrdelattrrrrlpoprI)rpexc_typeexc_valexc_tbrwrxryres rW __aexit__zContext.__aexit__s'')))  4 )  ! !$"4"4 5 D/ * 4 )  ! !$"4"4 5 D/ * 4 )  ! !$"4"4 5 D/ * <<LL$$&E  " "5 ) ) *sC=C;C%C=cJ tjS#t$rYywxYw)aAccess to the underlying request context. Returns None when the MCP session has not been established yet. Returns the full RequestContext once the MCP session is available. For HTTP request access in middleware, use `get_http_request()` from fastmcp.server.dependencies, which works whether or not the MCP session is available. Example in middleware: ```python async def on_request(self, context, call_next): ctx = context.fastmcp_context if ctx.request_context: # MCP session available - can access session_id, request_id, etc. session_id = ctx.session_id else: # MCP session not available yet - use HTTP helpers from fastmcp.server.dependencies import get_http_request request = get_http_request() return await call_next(context) ``` N)rrz LookupErrorrps rWrequest_contextzContext.request_contexts&0 ??$ $  s  ""NcK|jr6|jjr |jjjnd}|y|jj |||||j d{y7w)zReport progress for the current operation. Args: progress: Current progress value e.g. 24 total: Optional total value e.g. 100 N)progress_tokenprogresstotalmessagerelated_request_id)rmeta progressTokensessionsend_progress_notification request_id)rprrrrs rWreport_progresszContext.report_progresss}##(<(<(A(A  % % 3 3   ! ll55)# 6   sA5A?7A=8A?cRK|jjd{S7w)zList all available resources from the server. Returns: List of Resource objects available on the server N)rq_list_resources_mcprs rWlist_resourceszContext.list_resources#s! \\557777 '%'cRK|jjd{S7w)zList all available prompts from the server. Returns: List of Prompt objects available on the server N)rq_list_prompts_mcprs rW list_promptszContext.list_prompts+s! \\335555rcVK|jj||d{S7w)zGet a prompt by name with optional arguments. Args: name: The name of the prompt to get arguments: Optional arguments to pass to the prompt Returns: The prompt result N)rq_get_prompt_mcp)rpr: argumentss rW get_promptzContext.get_prompt3s%\\11$ BBBBs )')cTK|jj|d{S7w)zRead a resource by URI. Args: uri: Resource URI to read Returns: The resource content as either text or bytes N)rq_read_resource_mcp)rpuris rW read_resourcezContext.read_resourceAs#\\44S9999s (&(cKt||}t||j|xsd||jd{y7w)aSend a log message to the client. Messages sent to Clients are also logged to the `fastmcp.server.context.to_client` logger with a level of `DEBUG`. Args: message: Log message level: Optional log level. One of "debug", "info", "notice", "warning", "error", "critical", "alert", or "emergency". Default is "info". logger_name: Optional logger name extra: Optional mapping for additional arguments )rMrOrY)datarlevel logger_namerN)rK_log_to_server_and_clientrr)rprrrrOrs rWlogz Context.logMsA$7%0'LL/6##    s9AAAc|jr7|jjr!t|jjddSdS)zGet the client ID if available. client_idN)rrgetattrrs rWrzContext.client_idisD ##(<(<(A(A D((--{D A  rVcn|j tdt|jjS)zrGet the unique ID for this request. Raises RuntimeError if MCP request context is not available. zrequest_id is not available because the MCP session has not been established yet. Check `context.request_context` for None before accessing this attribute.)rrtrLrrs rWrzContext.request_idrs<    '\ 4''2233rVc|j}| td|j}t|dd}||S|j}|r|j j d}|ddlm}t|}||_ |S)aGet the MCP session ID for ALL transports. Returns the session ID that can be used as a key for session-based data storage (e.g., Redis) to share data between tool calls within the same client session. Returns: The session ID for StreamableHTTP transports, or a generated ID for other transports. Raises: RuntimeError if MCP request context is not available. Example: ```python @server.tool def store_data(data: dict, ctx: Context) -> str: session_id = ctx.session_id redis_client.set(f"session:{session_id}:data", json.dumps(data)) return f"Data stored for session {session_id}" ``` Nzsession_id is not available because the MCP session has not been established yet. Check `context.request_context` for None before accessing this attribute. _fastmcp_idzmcp-session-idr)uuid4) rrtrrrequestheadersrzuuidrrLr)rprr session_idrrs rWrzContext.session_ids0**  \ %%WmT:  ! %%  ,,-=>J   "UWJ)rVc\|j td|jjS)zAccess to the underlying session for advanced usage. Raises RuntimeError if MCP request context is not available. zsession is not available because the MCP session has not been established yet. Check `context.request_context` for None before accessing this attribute.)rrtrrs rWrzContext.sessions7    '\ ##+++rVcJK|jd|||d{y7w)zSend a `DEBUG`-level message to the connected MCP Client. Messages sent to Clients are also logged to the `fastmcp.server.context.to_client` logger with a level of `DEBUG`.rXrrrrONrrprrrOs rWrXz Context.debug/hh#    #!#cJK|jd|||d{y7w)zSend a `INFO`-level message to the connected MCP Client. Messages sent to Clients are also logged to the `fastmcp.server.context.to_client` logger with a level of `DEBUG`.rYrNrrs rWrYz Context.infos/hh#    rcJK|jd|||d{y7w)zSend a `WARNING`-level message to the connected MCP Client. Messages sent to Clients are also logged to the `fastmcp.server.context.to_client` logger with a level of `DEBUG`.r[rNrrs rWr[zContext.warnings/hh#    rcJK|jd|||d{y7w)zSend a `ERROR`-level message to the connected MCP Client. Messages sent to Clients are also logged to the `fastmcp.server.context.to_client` logger with a level of `DEBUG`.r\rNrrs rWr\z Context.errorrrcjK|jjd{}|jS7w)zCList the roots available to the server, as indicated by the client.N)r list_rootsroots)rpresults rWrzContext.list_rootss*||..00||1s 313cTK|jjd{y7w)z4Send a tool list changed notification to the client.N)rsend_tool_list_changedrs rWrzContext.send_tool_list_changedsll11333 (&(cTK|jjd{y7w)z8Send a resource list changed notification to the client.N)rsend_resource_list_changedrs rWrz"Context.send_resource_list_changed sll55777rcTK|jjd{y7w)z6Send a prompt list changed notification to the client.N)rsend_prompt_list_changedrs rWrz Context.send_prompt_list_changedsll33555rcK|jr|jjstjdy|jjd{y7w)aClose the current response stream to trigger client reconnection. When using StreamableHTTP transport with an EventStore configured, this method gracefully closes the HTTP connection for the current request. The client will automatically reconnect (after `retry_interval` milliseconds) and resume receiving events from where it left off via the EventStore. This is useful for long-running operations to avoid load balancer timeouts. Instead of holding a connection open for minutes, you can periodically close and let the client reconnect. Example: ```python @mcp.tool async def long_running_task(ctx: Context) -> str: for i in range(100): await ctx.report_progress(i, 100) # Close connection every 30 iterations to avoid LB timeouts if i % 30 == 0 and i > 0: await ctx.close_sse_stream() await do_work() return "Done" ``` Note: This is a no-op (with a debug log) if not using StreamableHTTP transport with an EventStore configured. zaclose_sse_stream() called but not applicable (requires StreamableHTTP transport with event_store)N)rclose_sse_streamr;rXrs rWrzContext.close_sse_streamsN>##4+?+?+P+P LLG  ""33555sAA AA T) system_prompt temperature max_tokensmodel_preferencestools tool_choicer4mask_error_detailsc Kt|} t|} | r| D cgc]} | jc} nd} | r| D cic]} | j| c} ni}t |t | }d}|0|dvrt d|dtttd|}||nd}|rt|| ||||| |d{}n>|jj| |||t|| ||jd{}t|t xr|j"d k(}| j%t'd |j( |s t+|| S|s t+|| St-|}|rH| | nt.j0}t3||| d{}|r| j%t'd| t+|| Scc} wcc} w777>w)ao Make a single LLM sampling call. This is a stateless function that makes exactly one LLM call and optionally executes any requested tools. Use this for fine-grained control over the sampling loop. Args: messages: The message(s) to send. Can be a string, list of strings, or list of SamplingMessage objects. system_prompt: Optional system prompt for the LLM. temperature: Optional sampling temperature. max_tokens: Maximum tokens to generate. Defaults to 512. model_preferences: Optional model preferences. tools: Optional list of tools the LLM can use. tool_choice: Tool choice mode ("auto", "required", or "none"). execute_tools: If True (default), execute tool calls and append results to history. If False, return immediately with tool_calls available in the step for manual execution. mask_error_details: If True, mask detailed error messages from tool execution. When None (default), uses the global settings value. Tools can raise ToolError to bypass masking. Returns: SampleStep containing: - .response: The raw LLM response - .history: Messages including input, assistant response, and tool results - .is_tool_use: True if the LLM requested tool execution - .tool_calls: List of tool calls (if any) - .text: The text content (if any) Example: messages = "Research X" while True: step = await ctx.sample_step(messages, tools=[search]) if not step.is_tool_use: print(step.text) break # Continue with tool results messages = step.history NrDzInvalid tool_choice: z(. Must be 'auto', 'required', or 'none'.modei)rrrr sdk_toolsr)messagesrrrrrrrtoolUse assistantrolecontent)responsehistory)ruser)_prepare_messages_prepare_tools _to_sdk_toolr:r3bool ValueErrorrrrr2rcreate_messager1r isinstancer stopReasonr}rrr._extract_tool_callsr(rrun_sampling_tools)rprrrrrrrr4rcurrent_messagessampling_toolstrtool_map use_fallbackeffective_tool_choiceeffective_max_tokensris_tool_use_responsestep_tool_callseffective_mask tool_resultss rW sample_stepzContext.sample_step9s=t-X6(.:H~ 6!Q^^  6d 4B /1QVVQY /r  .dD4HI 48  "">> +K?;==%/'"<={K% ! .8-Cz 2 +'/"3#1  H"\\88)+'/":;L"M1#'??9  H x!= > 1##y0   h6F6F G $x9IJ Jx9IJ J.h7 &1#00  "4n"L ''## ,85EFFo 7 0.  LsMGG  GGA,GG>GGBGG:GGG)rrrrrrc Kyw)zR>R=ST33 &diiRH LL $|| KiT lCNCSSTUVVk P / LL// /)/(91>6?ll0;9?:LQCP\9\125.59 )*-&!"sFA4I%6G=78I%0AI%AHB I% I" AII%I""I%c KywrbrUrpr response_types rWelicitzContext.elicits  rc KywrbrUr.s rWr0zContext.elicits ORrc KywrbrUr.s rWr0zContext.elicits QTrcvKt|}|jj||j|jd{}|j dk(rt ||jS|j dk(r tS|j dk(r tStd|j 7sw)a Send an elicitation request to the client and await the response. Call this method at any time to request additional information from the user through the client. The client must support elicitation, or the request will error. Note that the MCP protocol only supports simple object schemas with primitive types. You can provide a dataclass, TypedDict, or BaseModel to comply. If you provide a primitive type, an object schema with a single "value" field will be generated for the MCP interaction and automatically deconstructed into the primitive type upon response. If the response_type is None, the generated schema will be that of an empty object in order to comply with the MCP protocol requirements. Clients must send an empty object ("{}")in response. Args: message: A human-readable message explaining what information is needed response_type: The type of the response, which should be a primitive type or dataclass or BaseModel. If it is a primitive type, an object schema with a single "value" field will be generated. )rrequestedSchemarNacceptdeclinecancelzUnexpected elicitation action: ) r-rr0schemaractionr,rr+r*r)rprr/configrs rWr0zContext.elicitsF,M:||**"MM#+   ==H $'? ? ]]i '&( ( ]]h &') )>v}}oNO O sAB9B7A4B9c"||j|<y)z!Set a value in the context state.N)rn)rpkeyrs rW set_statezContext.set_states  CrVc8|jj|S)zIGet a value from the context state. Returns None if the key is not found.)rnrz)rpr<s rW get_statezContext.get_states{{s##rVc:|jjdy)z'Queue a tool list changed notification. notifications/tools/list_changedNrmaddrs rW_queue_tool_list_changedz Context._queue_tool_list_changeds   $$%GHrVc:|jjdy)z+Queue a resource list changed notification.$notifications/resources/list_changedNrBrs rW_queue_resource_list_changedz$Context._queue_resource_list_changeds   $$%KLrVc:|jjdy)z)Queue a prompt list changed notification."notifications/prompts/list_changedNrBrs rW_queue_prompt_list_changedz"Context._queue_prompt_list_changeds   $$%IJrVc<Kt4d{|js dddd{y d|jvr"|jjd{d|jvr"|jj d{d|jvr"|jj d{|jj dddd{y7777e77#t$rY&wxYw7#1d{7swYyxYww)zSend all queued notifications.NrArFrI) _flush_lockrmrrrrclear Exceptionrs rWrzContext._flush_notificationss  ++    59Q9QQ,,==???9T=U=UU,,AACCC74;S;SS,,??AAA((..0     @CA      s DC,DD DC.D+C6C0/C6 C2 /C6<C4=C6 D&D'D.D0C62C64C66 D?DDDDD D DD)rqr5)returnr5)rOr`)rONone)rOz2RequestContext[ServerSession, Any, Request] | NoneNN)rfloatr float | Noner str | NonerOrP)rOzlist[SDKResource])rOzlist[SDKPrompt]rb)r:rLrzdict[str, Any] | NonerOr)rz str | AnyUrlrOzlist[ReadResourceContents])NNN) rrLrzLoggingLevel | NonerrTrOrNrOrP)rOrT)rOrL)rOr)rrLrrTrOrNrOrP)rOz list[Root])r%str | Sequence[str | SamplingMessage]rrTrrSr int | Noner)ModelPreferences | str | list[str] | Noner2Sequence[SamplingTool | Callable[..., Any]] | NonerzToolChoiceOption | str | Noner4rr bool | NonerOr.)rrUrrTrrSrrVrrWrrXrz type[ResultT]rrYrOzSamplingResult[ResultT])rrUrrTrrSrrVrrWrrXrrPrrYrOzSamplingResult[str])rrUrrTrrSrrVrrWrrXrztype[ResultT] | NonerrYrOz-SamplingResult[ResultT] | SamplingResult[str])rrLr/rPrOzPAcceptedElicitation[dict[str, Any]] | DeclinedElicitation | CancelledElicitation)rrLr/ztype[T]rOzCAcceptedElicitation[T] | DeclinedElicitation | CancelledElicitation)rrLr/z list[str]rOzEAcceptedElicitation[str] | DeclinedElicitation | CancelledElicitation)rrLr/z6type[T] | list[str] | dict[str, dict[str, str]] | NonerOzAcceptedElicitation[T] | AcceptedElicitation[dict[str, Any]] | AcceptedElicitation[str] | AcceptedElicitation[list[str]] | DeclinedElicitation | CancelledElicitation)r<rLrr rOrP)r<rLrOr )'rPrQrRrSrrpropertyrqrrrrrrrrrrrrrrXrYr[r\rrrrrrrrr0r=r?rDrGrJrrUrVrWr`r`tsV*X) @*6:RV  &2 DN  686=A C C$9 C  C :&*"&*.   #   (    8   4 411f , , #'*.     (    &#'*.     (    &#'*.     (    &#'*.     (     486%6V%)$(!%GKDH59"*.VG7VG" VG " VG  VGEVGBVG3VGVG(VG VGp %)$(!%GKDH*. K7 K" K " K  KE KB K# K( K ! K K %)$(!%GKDH *. J7 J" J " J  JE JB J J( J  J J$%)$(!%GKDH,0*.ZW7ZW" ZW " ZW  ZWEZWBZW*ZW(ZW 7ZWx   Y   RRR M RR TT!T O TT , QU2P2PN2P   2Ph!$IMKrVcKd|jd}|r |d|dz }tjt||d|j|j |j ||||d{y7w) z'Log a message to the server and client.zSending z to clientz (rz: )rrMrO)rrr;rN)upperr>r_mcp_level_to_python_levelrMrOsend_log_message)rrrrr msg_prefixs rWrrsEKKM?*5J;-q)) (/l"TXXJ 'jj  " " - # sA0A:2A83A:ct|}|j}t|d}|jddk7r dd|idgd}d d}t dd || S) zCreate a synthetic 'final_response' tool for structured output. This tool is used to capture structured responses from the LLM. The tool's schema is derived from the result_type. Tr r rr)r  propertiesrFc|SrbrU)kwargss rWr z3_create_final_response_tool..final_response5s rVr z|Call this tool to provide your final response. Use this when you have completed the task and are ready to return the result.)r: description parametersfn)rcr rOzdict[str, Any])r9rr6rzr0)rr(r8r s rWrr"sw *+6L  % % 'F V$ 7Fzz&X%"F+     \  rVct|tr&|D] }t|ts|jcSyt|tr |jSy)zExtract text from content block(s). Returns the text if content is a TextContent or list containing TextContent, otherwise returns None. N)rrrr)rblocks rW_extract_text_from_contentriCsM'4  "E%-zz! " G[ )|| rVc t|trtt|ddgS|Dcgc],}t|trtt|ddn|.c}Scc}w)zEConvert various message formats to a list of SamplingMessage objects.r)rr r)rr)rrLrr)rms rWrrUsr(C #?f     !S! KQV$D6 R    s1A"c|yg}|D]j}t|tr|j|%t|r%|jtj|Ut dt ||r|SdS)z&Convert tools to SamplingTool objects.Nz'Expected SamplingTool or callable, got )rr0r}callable from_function TypeErrorr )rrrs rWrrhs })+N Q a &  ! !! $ a[  ! !,"<"55rVc|j}t|tr!|Dcgc]}t|ts|c}St|tr|gSgScc}w)z#Extract tool calls from a response.)rrrr )rrcs rWrr{sPG'4 "DajN&CDD G^ ,y IEs AA)rHr`rOzGenerator[Context, None, None]rQ) rrKrrrrrrTrrTrOrP)rr rOr0)rz?SamplingMessageContentBlock | list[SamplingMessageContentBlock]rOrT)rrUrOzlist[SamplingMessage])rrXrOzlist[SamplingTool] | None)rz2CreateMessageResult | CreateMessageResultWithToolsrOzlist[ToolUseContent])r __future__rr{rloggingricollections.abcrrrr contextlibr contextvarsr r dataclassesr r typingr rrranyiomcprr mcp.server.lowlevel.helper_typesrmcp.server.lowlevel.serverrmcp.shared.contextr mcp.typesrrrrrrrrrrr r! SDKPromptr" SDKResourcer#SDKToolpydanticr$pydantic.networksr%starlette.requestsr&typing_extensionsr'rqr(fastmcp.server.elicitationr)r*r+r,r-fastmcp.server.samplingr.r/r0fastmcp.server.sampling.runr1r2r3r4rfastmcp.server.serverr5fastmcp.utilities.json_schemar6fastmcp.utilities.loggingr7r8fastmcp.utilities.typesr9rPr;rTgetChildr>rArLrCToolChoiceOptionrILockrLrKr?INFOWARNINGERRORCRITICALr]rfr`rrrirrrrUrVrWrsF" BB%)!// +A2-    *-%$$&%ML *9?:**!??+?>&> %9 C )S )56/9)T/R,Rejjl  ++ +]] LLll ]]    !! && NN Nj#%)      #   8B L$ 3  &6 =66& @  rV